Protein Global Alignment

Description

Query:
ccsbBroad304_99985
Subject:
eGFP.1
Aligned Length:
240
Identities:
234
Gaps:
1

Alignment

Query   1  MVSKGQQLFTGVVPILVQLDGDVNGHKFSVSGQGQGDATYGKLTLKFICTTGKLPVPWPTLVTTLSHGVQCFSR  74
           |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||..|||||||
Sbjct   1  MVSKGQQLFTGVVPILVQLDGDVNGHKFSVSGQGQGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSR  74

Query  75  YPDHMKQHDFFKSAMPQGYVQQRTIFFKDDGNYKTRAQVKFQGDTLVNRIQLKGIDFKQDGNILGHKLQYNFNS  148
           |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||.||
Sbjct  75  YPDHMKQHDFFKSAMPQGYVQQRTIFFKDDGNYKTRAQVKFQGDTLVNRIQLKGIDFKQDGNILGHKLQYNYNS  148

Query 149  HNVYIMADKQKNGIKANFKIRHNIQDGSVQLADHYQQNTPIGDGPVLLPDSHYLSTQSALSKDPNQKRDHMVLL  222
           ||||||||||||||||||||||||||||||||||||||||||||||||||.|||||||||||||||||||||||
Sbjct 149  HNVYIMADKQKNGIKANFKIRHNIQDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNQKRDHMVLL  222

Query 223  QFVTAAGITLGMDQLYX-  239
           ||||||||||||||||. 
Sbjct 223  QFVTAAGITLGMDQLYKS  240