Protein Global Alignment

Description

Query:
ccsbBroad301_99985
Subject:
clonetechGfp.1
Aligned Length:
239
Identities:
234
Gaps:
0

Alignment

Query   1  MVSKGQQLFTGVVPILVQLDGDVNGHKFSVSGQGQGDATYGKLTLKFICTTGKLPVPWPTLVTTLSHGVQCFSR  74
           |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||..|||||||
Sbjct   1  MVSKGQQLFTGVVPILVQLDGDVNGHKFSVSGQGQGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSR  74

Query  75  YPDHMKQHDFFKSAMPQGYVQQRTIFFKDDGNYKTRAQVKFQGDTLVNRIQLKGIDFKQDGNILGHKLQYNFNS  148
           |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||.||
Sbjct  75  YPDHMKQHDFFKSAMPQGYVQQRTIFFKDDGNYKTRAQVKFQGDTLVNRIQLKGIDFKQDGNILGHKLQYNYNS  148

Query 149  HNVYIMADKQKNGIKANFKIRHNIQDGSVQLADHYQQNTPIGDGPVLLPDSHYLSTQSALSKDPNQKRDHMVLL  222
           |||||||||||||||.||||||||||||||||||||||||||||||||||.|||||||||||||||||||||||
Sbjct 149  HNVYIMADKQKNGIKVNFKIRHNIQDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNQKRDHMVLL  222

Query 223  QFVTAAGITLGMDQLYK  239
           |||||||||||||||||
Sbjct 223  QFVTAAGITLGMDQLYK  239