Protein Global Alignment

Description

Query:
ccsbBroad301_99985
Subject:
BFP.1
Aligned Length:
239
Identities:
239
Gaps:
0

Alignment

Query   1  MVSKGQQLFTGVVPILVQLDGDVNGHKFSVSGQGQGDATYGKLTLKFICTTGKLPVPWPTLVTTLSHGVQCFSR  74
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct   1  MVSKGQQLFTGVVPILVQLDGDVNGHKFSVSGQGQGDATYGKLTLKFICTTGKLPVPWPTLVTTLSHGVQCFSR  74

Query  75  YPDHMKQHDFFKSAMPQGYVQQRTIFFKDDGNYKTRAQVKFQGDTLVNRIQLKGIDFKQDGNILGHKLQYNFNS  148
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct  75  YPDHMKQHDFFKSAMPQGYVQQRTIFFKDDGNYKTRAQVKFQGDTLVNRIQLKGIDFKQDGNILGHKLQYNFNS  148

Query 149  HNVYIMADKQKNGIKANFKIRHNIQDGSVQLADHYQQNTPIGDGPVLLPDSHYLSTQSALSKDPNQKRDHMVLL  222
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct 149  HNVYIMADKQKNGIKANFKIRHNIQDGSVQLADHYQQNTPIGDGPVLLPDSHYLSTQSALSKDPNQKRDHMVLL  222

Query 223  QFVTAAGITLGMDQLYK  239
           |||||||||||||||||
Sbjct 223  QFVTAAGITLGMDQLYK  239