Protein Global Alignment

Description

Query:
BRDN0000464780
Subject:
lacZ.1
Aligned Length:
1073
Identities:
989
Gaps:
53

Alignment

Query    1  --MID---PVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRFAWFPAPEAVPESW  69
              ||.   .|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct    1  MTMITDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRFAWFPAPEAVPESW  74

Query   70  LECDLPEADTVVVPSNWQMHGYDAPIYTNVTYPITVNPPFVPTENPTGCYSLTFNVDESWLQEGQTRIIFDGVN  143
            ||||||.|||||||||||||||||||||||||||||||||||.||||||||||||.||||||||||||||||||
Sbjct   75  LECDLPDADTVVVPSNWQMHGYDAPIYTNVTYPITVNPPFVPAENPTGCYSLTFNIDESWLQEGQTRIIFDGVN  148

Query  144  SAFHLWCNGRWVGYGQDSRLPSEFDLSAFLRAGENRLAVMVLRWSDGSYLEDQDMWRMSGIFRDVSLLHKPTTQ  217
            ||||||||||||||||||.|||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct  149  SAFHLWCNGRWVGYGQDSXLPSEFDLSAFLRAGENRLAVMVLRWSDGSYLEDQDMWRMSGIFRDVSLLHKPTTQ  222

Query  218  ISDFHVATRFNDDFSRAVLEAEVQMCGELRDYLRVTVSLWQGETQVASGTAPFGGEIIDERGGYADRVTLRLNV  291
            ||||.|.|.||||||||||||||||.|||||.||||||||||||||||||||||||||||||||||||||||||
Sbjct  223  ISDFQVTTLFNDDFSRAVLEAEVQMYGELRDELRVTVSLWQGETQVASGTAPFGGEIIDERGGYADRVTLRLNV  296

Query  292  ENPKLWSAEIPNLYRAVVELHTADGTLIEAEACDVGFREVRIENGLLLLNGKPLLIRGVNRHEHHPLHGQVMDE  365
            |||.||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct  297  ENPELWSAEIPNLYRAVVELHTADGTLIEAEACDVGFREVRIENGLLLLNGKPLLIRGVNRHEHHPLHGQVMDE  370

Query  366  QTMVQDILLMKQNNFNAVRCSHYPNHPLWYTLCDRYGLYVVDEANIETHGMVPMNRLTDDPRWLPAMSERVTRM  439
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct  371  QTMVQDILLMKQNNFNAVRCSHYPNHPLWYTLCDRYGLYVVDEANIETHGMVPMNRLTDDPRWLPAMSERVTRM  444

Query  440  VQRDRNHPSVIIWSLGNESGHGANHDALYRWIKSVDPSRPVQYEGGGADTTATDIICPMYARVDEDQPFPAVPK  513
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct  445  VQRDRNHPSVIIWSLGNESGHGANHDALYRWIKSVDPSRPVQYEGGGADTTATDIICPMYARVDEDQPFPAVPK  518

Query  514  WSIKKWLSLPGETRPLILCEYAHAMGNSLGGFAKYWQAFRQYPRLQGGFVWDWVDQSLIKYDENGNPWSAYGGD  587
            ||||||||||||.|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct  519  WSIKKWLSLPGEMRPLILCEYAHAMGNSLGGFAKYWQAFRQYPRLQGGFVWDWVDQSLIKYDENGNPWSAYGGD  592

Query  588  FGDTPNDRQFCMNGLVFADRTPHPALTEAKHQQQFFQFRLSGQTIEVTSEYLFRHSDNELLHWMVALDGKPLAS  661
            ||||||||||||||||||||||||||||||||||.|||||||.||||||||||||||||.||||||||||||||
Sbjct  593  FGDTPNDRQFCMNGLVFADRTPHPALTEAKHQQQYFQFRLSGRTIEVTSEYLFRHSDNEFLHWMVALDGKPLAS  666

Query  662  GEVPLDVAPQGKQLIELPELPQPESAGQLWLTVRVVQPNATAWSEAGHISAWQQWRLAENLSVTLPAASHAIPH  735
            |||||||.||||||||||||||||||||||||||||||||||||||||||||||||||||||||||.||||||.
Sbjct  667  GEVPLDVGPQGKQLIELPELPQPESAGQLWLTVRVVQPNATAWSEAGHISAWQQWRLAENLSVTLPSASHAIPQ  740

Query  736  LTTSEMDFCIELGNKRWQFNRQSGFLSQMWIGDKKQLLTPLRDQFTRAPLDNDIGVSEATRIDPNAWVERWKAA  809
            ||||..|||||||||||||||||||||||||||.||||||||||||||||||||||||||||||||||||||||
Sbjct  741  LTTSGTDFCIELGNKRWQFNRQSGFLSQMWIGDEKQLLTPLRDQFTRAPLDNDIGVSEATRIDPNAWVERWKAA  814

Query  810  GHYQAEAALLQCTADTLADAVLITTAHAWQHQGKTLFISRKTYRIDGSGQMAITVDVEVASDTPHPARIGLNCQ  883
            |||||||||||||||||||||||||||||||||||||||||||||||.|.|.|.|||.|||||||||||||.||
Sbjct  815  GHYQAEAALLQCTADTLADAVLITTAHAWQHQGKTLFISRKTYRIDGHGEMVINVDVAVASDTPHPARIGLTCQ  888

Query  884  LAQVAERVNWLGLGPQENYPDRLTAACFDRWDLPLSDMYTPYVFPSENGLRCGTRELNYGPHQWRGDFQFNISR  957
            ||||.|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct  889  LAQVSERVNWLGLGPQENYPDRLTAACFDRWDLPLSDMYTPYVFPSENGLRCGTRELNYGPHQWRGDFQFNISR  962

Query  958  YSQQQLMETSHRHLLHAEEGTWLNIDGFHMGIGGDDSWSPSVSAELQLSAGRYHYQLVWCQKTKGGRADPAFLY  1031
            |||||||||||||||||||||||||||||||||||||||||||||.||||||||||||||||.           
Sbjct  963  YSQQQLMETSHRHLLHAEEGTWLNIDGFHMGIGGDDSWSPSVSAEFQLSAGRYHYQLVWCQKX-----------  1025

Query 1032  KVVDIQHSGGRSSLEGPRFEGKPIPNPLLGLDSTRTG  1068
                                                 
Sbjct 1026  -------------------------------------  1025