Protein Global Alignment

Description

Query:
BRDN0000464765
Subject:
HcRed.1
Aligned Length:
229
Identities:
228
Gaps:
1

Alignment

Query   1  MVSGLLKQSMRIKMYMQGTVNGHYFKCQGQGDGNPFAGTQSMRIHVTQGAPLPFAFDILAPCCQYGSRTFVHHT  74
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct   1  MVSGLLKQSMRIKMYMQGTVNGHYFKCQGQGDGNPFAGTQSMRIHVTQGAPLPFAFDILAPCCQYGSRTFVHHT  74

Query  75  AQIPDFFKQSFPQGFTWQRTTTYQDGGILTAHQDTSLQGNCLIYKVKVHGTNFPADGPVMKNKSGGWQPSTQVV  148
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct  75  AQIPDFFKQSFPQGFTWQRTTTYQDGGILTAHQDTSLQGNCLIYKVKVHGTNFPADGPVMKNKSGGWQPSTQVV  148

Query 149  YPQNGVLCGRNVMALKVGDRHLICHHYTSYRSKKAVRALTMPGFHFTDIRLQMLRKKKDQYFQLYQASVARYSD  222
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct 149  YPQNGVLCGRNVMALKVGDRHLICHHYTSYRSKKAVRALTMPGFHFTDIRLQMLRKKKDQYFQLYQASVARYSD  222

Query 223  LPQKAN-  228
           |||||| 
Sbjct 223  LPQKANL  229